PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g35500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 430aa    MW: 49160.1 Da    PI: 5.8184
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g35500genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.53.9e-323591158
   CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                dep++VNaKQyq+Il+RRq Rakle+++kl +k+rkpylheSRh+hAl+R+Rg+gGrF
  CA03g35500 35 DEPIFVNAKQYQAILRRRQYRAKLEAQNKL-SKARKPYLHESRHRHALNRARGPGGRF 91
                79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.0E-353394IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.0883494IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.6E-273691IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-223759IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068603959IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-226891IPR001289Nuclear transcription factor Y subunit A
PfamPF121654.2E-45188293IPR021998Alfin
SuperFamilySSF579033.54E-16366426IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.1E-16368425IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS500169.259373425IPR019787Zinc finger, PHD-finger
SMARTSM002491.6E-8375423IPR001965Zinc finger, PHD-type
CDDcd156135.29E-24375425No hitNo description
PROSITE patternPS013590376422IPR019786Zinc finger, PHD-type, conserved site
PfamPF006284.1E-10376424IPR019787Zinc finger, PHD-finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0042393Molecular Functionhistone binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MPTVRYLPFS FLQVQSQMLG TVSPRVPLPV DLQQDEPIFV NAKQYQAILR RRQYRAKLEA  60
QNKLSKARKP YLHESRHRHA LNRARGPGGR FVNKKKPQES KFPDLINGQD DQVPEHELQL  120
NTKMLELDVH QSGSYKGSSS TPVYSSIASV SNSAAIYHHQ PLKYSAFSSC IGGTSQQNKE  180
KDHISNPDVE EFFKLCDPGK ENLCLYGLPN GQWEVKLPAE DLPPSLPDPV VGINFARDGM  240
PQKEWLSFIA YHCDAWLLSV AFHASGRFGF DKADREKLFD MINDFPTIHN LMTDDPETQQ  300
KEQPTVTDKR KNKSKPNPSK VKDYRASESQ GKLTKLQKKY EEEEDDNGED IGEEEEGEEG  360
WDIEKDDEEM QDETLCGACG EKYQEDEFWI CCDKCETWFH GECVKITAAT AEYIKQYKCR  420
PCSSKRYRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1we9_A5e-20376425958PHD finger family protein
4awl_A6e-2035105269NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9281923e-65CU928192.4 S.lycopersicum DNA sequence from clone LE_HBa-142A5, complete sequence.
GenBankHG9755153e-65HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562507.11e-153PREDICTED: PHD finger protein ALFIN-LIKE 4-like isoform X2
RefseqXP_016562506.11e-153PREDICTED: PHD finger protein ALFIN-LIKE 4-like isoform X1
SwissprotQ7XUW34e-78ALFL4_ORYSJ; PHD finger protein ALFIN-LIKE 4
TrEMBLM0ZR781e-111M0ZR78_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000063651e-111(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.13e-38nuclear factor Y, subunit A5